<entry id="STF0006" title="Bacteriophage lambda lysozyme">
  
  <protein name="Endolysin" organism="Escherichia phage lambda" number_of_residues="158" uniprot_id="P03706" uniprot_range="1-158" pdb_id="1am7">
    
    <experiment id="30">
      <method type="folding">Pulse labeling HDX NMR and MS</method>
      <conditions pH="5.6 - 5.6" temperature="20.0" probes="54">None</conditions>
      <protection protection_level="EARLY">refolding time constant &lt; 180</protection>
      <sequence is_pdb="True">MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLKSTGAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDIRQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEAGGTVREIDV</sequence>
      <details>Samples were prepared using a QFM-5 rapid-mixing quenched-flow device. Standard pulse-labeling procedure was performed, in which deuterated unfolded lysozyme (5 mg/ml in 3 M Gdm2HCl and 500 mM DTT) was exposed to a high pH labeling pulse after various refolding periods (3.5-2000 ms) at 20 °C in 20 mM sodium acetate buffer, pH 5.6.</details>
      
        
        <residue index="10" code="A"></residue>
        
      
        
        <residue index="11" code="F"></residue>
        
      
        
        <residue index="12" code="L"></residue>
        
      
        
        <residue index="14" code="M"></residue>
        
      
        
        <residue index="16" code="A"></residue>
        
      
        
        <residue index="18" code="S"></residue>
        
      
        
        <residue index="20" code="G"></residue>
        
      
        
        <residue index="21" code="T"></residue>
        
      
        
        <residue index="35" code="V"></residue>
        
      
        
        <residue index="41" code="L"></residue>
        
      
        
        <residue index="42" code="F"></residue>
        
      
        
        <residue index="64" code="A"></residue>
        
      
        
        <residue index="69" code="L"></residue>
        
      
        
        <residue index="74" code="W"></residue>
        
      
        
        <residue index="81" code="L"></residue>
        
      
        
        <residue index="83" code="L"></residue>
        
      
        
        <residue index="90" code="S"></residue>
        
      
        
        <residue index="91" code="Q"></residue>
        
      
        
        <residue index="96" code="L"></residue>
        
      
        
        <residue index="97" code="Q"></residue>
        
      
        
        <residue index="98" code="Q"></residue>
        
      
        
        <residue index="101" code="E"></residue>
        
      
        
        <residue index="102" code="R"></residue>
        
      
        
        <residue index="112" code="D"></residue>
        
      
        
        <residue index="117" code="I"></residue>
        
      
        
        <residue index="118" code="D"></residue>
        
      
        
        <residue index="146" code="F"></residue>
        
      
        
        <residue index="147" code="K"></residue>
        
      
        
        <residue index="152" code="T"></residue>
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
    </experiment>
    
    <experiment id="31">
      <method type="folding">Pulse labeling HDX NMR and MS</method>
      <conditions pH="5.6 - 5.6" temperature="20.0" probes="54">None</conditions>
      <protection protection_level="INTERMEDIATE">180 &lt; refolding time constant &lt; 200</protection>
      <sequence is_pdb="True">MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLKSTGAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDIRQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEAGGTVREIDV</sequence>
      <details>Samples were prepared using a QFM-5 rapid-mixing quenched-flow device. Standard pulse-labeling procedure was performed, in which deuterated unfolded lysozyme (5 mg/ml in 3 M Gdm2HCl and 500 mM DTT) was exposed to a high pH labeling pulse after various refolding periods (3.5-2000 ms) at 20 °C in 20 mM sodium acetate buffer, pH 5.6.</details>
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
        <residue index="9" code="K"></residue>
        
      
        
        <residue index="13" code="D"></residue>
        
      
        
        <residue index="15" code="L"></residue>
        
      
        
        <residue index="19" code="E"></residue>
        
      
        
        <residue index="93" code="A"></residue>
        
      
        
        <residue index="94" code="V"></residue>
        
      
        
        <residue index="95" code="A"></residue>
        
      
        
        <residue index="108" code="I"></residue>
        
      
        
        <residue index="109" code="D"></residue>
        
      
        
        <residue index="110" code="R"></residue>
        
      
        
        <residue index="119" code="R"></residue>
        
      
        
        <residue index="120" code="C"></residue>
        
      
        
        <residue index="144" code="A"></residue>
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
    </experiment>
    
    <experiment id="32">
      <method type="folding">Pulse labeling HDX NMR and MS</method>
      <conditions pH="5.6 - 5.6" temperature="20.0" probes="54">None</conditions>
      <protection protection_level="LATE">refolding time constant &gt; 200</protection>
      <sequence is_pdb="True">MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLKSTGAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDIRQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEAGGTVREIDV</sequence>
      <details>Samples were prepared using a QFM-5 rapid-mixing quenched-flow device. Standard pulse-labeling procedure was performed, in which deuterated unfolded lysozyme (5 mg/ml in 3 M Gdm2HCl and 500 mM DTT) was exposed to a high pH labeling pulse after various refolding periods (3.5-2000 ms) at 20 °C in 20 mM sodium acetate buffer, pH 5.6.</details>
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
        <residue index="8" code="R"></residue>
        
      
        
        <residue index="17" code="W"></residue>
        
      
        
        <residue index="33" code="Y"></residue>
        
      
        
        <residue index="67" code="Y"></residue>
        
      
        
        <residue index="68" code="Q"></residue>
        
      
        
        <residue index="78" code="R"></residue>
        
      
        
        <residue index="87" code="S"></residue>
        
      
        
        <residue index="92" code="D"></residue>
        
      
        
        <residue index="100" code="K"></residue>
        
      
        
        <residue index="116" code="A"></residue>
        
      
        
        <residue index="145" code="K"></residue>
        
      
        
        <residue index="148" code="E"></residue>
        
      
        
        <residue index="149" code="A"></residue>
        
      
        
        <residue index="151" code="G"></residue>
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
    </experiment>
    
    <experiment id="33">
      <method type="stability">Native exchange NMR</method>
      <conditions pH="4.4 - 5.6" temperature="20.0" probes="66">None</conditions>
      <protection protection_level="STRONG">log(P) &gt; 5</protection>
      <sequence is_pdb="True">MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLKSTGAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDIRQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEAGGTVREIDV</sequence>
      <details>H/D exchange rates were measured using 2 mM 15N-labeled enzyme, on the basis of published resonance assignments. Exchange was initiated by a 10-fold dilution of a 2 mM 15N-labeled protein sample in 10 mM HEPES, pH 7.0, into a D2O solution at pH 5.6 or 4.4. Samples were subsequently concentrated 10-fold by ultrafiltration at 4 °C to give a final protein concentration of 2 mM; this procedure was repeated five times. Following exchange and concentration, the protein sample was subsequently analyzed by 2D NMR.</details>
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
        <residue index="11" code="F"></residue>
        
      
        
        <residue index="12" code="L"></residue>
        
      
        
        <residue index="14" code="M"></residue>
        
      
        
        <residue index="15" code="L"></residue>
        
      
        
        <residue index="17" code="W"></residue>
        
      
        
        <residue index="18" code="S"></residue>
        
      
        
        <residue index="19" code="E"></residue>
        
      
        
        <residue index="21" code="T"></residue>
        
      
        
        <residue index="35" code="V"></residue>
        
      
        
        <residue index="67" code="Y"></residue>
        
      
        
        <residue index="69" code="L"></residue>
        
      
        
        <residue index="92" code="D"></residue>
        
      
        
        <residue index="93" code="A"></residue>
        
      
        
        <residue index="94" code="V"></residue>
        
      
        
        <residue index="96" code="L"></residue>
        
      
        
        <residue index="97" code="Q"></residue>
        
      
        
        <residue index="98" code="Q"></residue>
        
      
        
        <residue index="99" code="I"></residue>
        
      
        
        <residue index="100" code="K"></residue>
        
      
        
        <residue index="108" code="I"></residue>
        
      
        
        <residue index="117" code="I"></residue>
        
      
        
        <residue index="120" code="C"></residue>
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
    </experiment>
    
    <experiment id="34">
      <method type="stability">Native exchange NMR</method>
      <conditions pH="4.4 - 5.6" temperature="20.0" probes="66">None</conditions>
      <protection protection_level="MEDIUM">3 &lt; log(P) &lt; 5</protection>
      <sequence is_pdb="True">MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLKSTGAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDIRQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEAGGTVREIDV</sequence>
      <details>H/D exchange rates were measured using 2 mM 15N-labeled enzyme, on the basis of published resonance assignments. Exchange was initiated by a 10-fold dilution of a 2 mM 15N-labeled protein sample in 10 mM HEPES, pH 7.0, into a D2O solution at pH 5.6 or 4.4. Samples were subsequently concentrated 10-fold by ultrafiltration at 4 °C to give a final protein concentration of 2 mM; this procedure was repeated five times. Following exchange and concentration, the protein sample was subsequently analyzed by 2D NMR.</details>
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
        <residue index="9" code="K"></residue>
        
      
        
        <residue index="10" code="A"></residue>
        
      
        
        <residue index="16" code="A"></residue>
        
      
        
        <residue index="20" code="G"></residue>
        
      
        
        <residue index="33" code="Y"></residue>
        
      
        
        <residue index="36" code="I"></residue>
        
      
        
        <residue index="42" code="F"></residue>
        
      
        
        <residue index="64" code="A"></residue>
        
      
        
        <residue index="65" code="G"></residue>
        
      
        
        <residue index="66" code="R"></residue>
        
      
        
        <residue index="68" code="Q"></residue>
        
      
        
        <residue index="74" code="W"></residue>
        
      
        
        <residue index="77" code="Y"></residue>
        
      
        
        <residue index="87" code="S"></residue>
        
      
        
        <residue index="90" code="S"></residue>
        
      
        
        <residue index="91" code="Q"></residue>
        
      
        
        <residue index="95" code="A"></residue>
        
      
        
        <residue index="109" code="D"></residue>
        
      
        
        <residue index="110" code="R"></residue>
        
      
        
        <residue index="112" code="D"></residue>
        
      
        
        <residue index="116" code="A"></residue>
        
      
        
        <residue index="119" code="R"></residue>
        
      
        
        <residue index="124" code="W"></residue>
        
      
        
        <residue index="144" code="A"></residue>
        
      
        
        <residue index="145" code="K"></residue>
        
      
        
        <residue index="146" code="F"></residue>
        
      
        
        <residue index="147" code="K"></residue>
        
      
        
        <residue index="148" code="E"></residue>
        
      
        
        <residue index="149" code="A"></residue>
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
    </experiment>
    
    <experiment id="35">
      <method type="stability">Native exchange NMR</method>
      <conditions pH="4.4 - 5.6" temperature="20.0" probes="66">None</conditions>
      <protection protection_level="WEAK">log(P) &lt; 3</protection>
      <sequence is_pdb="True">MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLKSTGAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDIRQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEAGGTVREIDV</sequence>
      <details>H/D exchange rates were measured using 2 mM 15N-labeled enzyme, on the basis of published resonance assignments. Exchange was initiated by a 10-fold dilution of a 2 mM 15N-labeled protein sample in 10 mM HEPES, pH 7.0, into a D2O solution at pH 5.6 or 4.4. Samples were subsequently concentrated 10-fold by ultrafiltration at 4 °C to give a final protein concentration of 2 mM; this procedure was repeated five times. Following exchange and concentration, the protein sample was subsequently analyzed by 2D NMR.</details>
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
      
        
        <residue index="8" code="R"></residue>
        
      
        
        <residue index="32" code="G"></residue>
        
      
        
        <residue index="41" code="L"></residue>
        
      
        
        <residue index="75" code="D"></residue>
        
      
        
        <residue index="76" code="A"></residue>
        
      
        
        <residue index="78" code="R"></residue>
        
      
        
        <residue index="81" code="L"></residue>
        
      
        
        <residue index="83" code="L"></residue>
        
      
        
        <residue index="101" code="E"></residue>
        
      
        
        <residue index="102" code="R"></residue>
        
      
        
        <residue index="118" code="D"></residue>
        
      
        
        <residue index="127" code="L"></residue>
        
      
        
        <residue index="142" code="L"></residue>
        
      
        
        <residue index="151" code="G"></residue>
        
      
        
        <residue index="152" code="T"></residue>
        
      
    </experiment>
    
  </protein>
  
</entry>
