Entry STF0046
Ribonuclease A
Protein information
| Name of the protein: | Ribonuclease pancreatic |
| Organism: | Bos taurus |
| Number of residues: | 124 |
| Related UniProt entry: | P61823 (Fragment: 27 - 150) |
| Related PDB entry: | 1RBX |
Visualize the data
Click here or on the image on the right to visualize the residues using JSmol. Warning: JSmol is known to load slowly on certain browsers, depending on the size of the macromolecule. The applet is optimized for Chrome, other browsers have limited support.
Experiment sets
STRONG
Method: Native exchange NMR
Conditions: pH 6.5; 35.0 Celsius; Probes: 46
Related publication:
PMID 7578123
Experiment details: "Prior to the HX reaction, RNase A was lyophilized from aqueous solution at pH 6.5 and sucrose was lyophilized twice from D2O solutions at pH* 6.5. HX reaction was initiated by dissolving the lyophilized protein into D2O. At different HX times, ranging from several minutes to about a week, aliquots (~0.6 mL) of the HX reaction were withdrawn and HX was quenched by dropping the pH* to 3.5 with DCl."
Protection threshold: strong protection
Sequence:
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
CLICK TO DOWNLOAD SEQUENCE IN FASTA
STRONG residues
46: F;
47: V;
55: Q;
58: C;
73: Y;
74: Q;
79: M;
81: I;
106: I;
108: V;
109: A;
CLICK TO DOWNLOAD LIST OF RESIDUES
EARLY
Method: Pulse labeling HDX NMR
Conditions: pH 4.0; 10.0 Celsius; Probes: 27
Related publication:
PMID 2236032
Experiment details: "The deuterated RNase A was unfolded in an unfolding buffer (2.65 M guanidine hydrochloride/40 mM glycine, in D2O at a final pH of 2). Refolding of the unfolded RNase A solution (60-70 mg of RNase A per ml) at pH 4 was initiated by diluting 10.5-fold into a refolding buffer (0.442 M sodium sulfate/0.055 M sodium formate, in H2O at pH 4.25). At different times after beginning refolding, the exchange pulse was initiated by diluting 1.5-fold into an exchange buffer [0.4 M sodium sulfate/0.25 M guanidine hydrochloride/0.1 M (final) glycine, in H2O] so that the final pH was 9 or 10. The 37-msec exchange pulse was terminated by diluting 1.33-fold into a quench buffer (0.4 M sodium sulfate/0.25 M guanidine hydrochloride/0.1 M sodium formate), so that the final pH was 2.9. The refolding reaction was then allowed to go to completion (10 min) at this pH. The mixing dead time was 5 msec for each of the three mixing events described above. For the zero time point, the exchange pulse was applied directly to the unfolded protein solution."
Protection threshold: strong protection in I1
Sequence:
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
CLICK TO DOWNLOAD SEQUENCE IN FASTA
EARLY residues
47: V;
48: H;
54: V;
63: V;
72: C;
73: Y;
81: I;
84: C;
98: K;
106: I;
108: V;
116: V;
118: V;
119: H;
CLICK TO DOWNLOAD LIST OF RESIDUES
INTERMEDIATE
Method: Pulse labeling HDX NMR
Conditions: pH 4.0; 10.0 Celsius; Probes: 27
Related publication:
PMID 2236032
Experiment details: "The deuterated RNase A was unfolded in an unfolding buffer (2.65 M guanidine hydrochloride/40 mM glycine, in D2O at a final pH of 2). Refolding of the unfolded RNase A solution (60-70 mg of RNase A per ml) at pH 4 was initiated by diluting 10.5-fold into a refolding buffer (0.442 M sodium sulfate/0.055 M sodium formate, in H2O at pH 4.25). At different times after beginning refolding, the exchange pulse was initiated by diluting 1.5-fold into an exchange buffer [0.4 M sodium sulfate/0.25 M guanidine hydrochloride/0.1 M (final) glycine, in H2O] so that the final pH was 9 or 10. The 37-msec exchange pulse was terminated by diluting 1.33-fold into a quench buffer (0.4 M sodium sulfate/0.25 M guanidine hydrochloride/0.1 M sodium formate), so that the final pH was 2.9. The refolding reaction was then allowed to go to completion (10 min) at this pH. The mixing dead time was 5 msec for each of the three mixing events described above. For the zero time point, the exchange pulse was applied directly to the unfolded protein solution."
Protection threshold: moderate protection in I1
Sequence:
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
CLICK TO DOWNLOAD SEQUENCE IN FASTA
INTERMEDIATE residues
31: K;
34: N;
43: V;
59: S;
60: Q;
97: Y;
CLICK TO DOWNLOAD LIST OF RESIDUES